PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G093500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 337aa    MW: 37264.2 Da    PI: 6.836
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G093500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.6e-52101391129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeel+ +yLkkk+  +k++l evi+evd++k+ePwdL++  ++ +  ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+
  Brast09G093500.1.p  10 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWDLQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGR 99 
                         69****************************.99**************963433332566******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk + + + +++g++ktLvfy+grap+g+k+dW+mheyrle
  Brast09G093500.1.p 100 DKCIRT-SYRKIGMRKTLVFYRGRAPHGQKSDWIMHEYRLE 139
                         *****9.8999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-596161IPR003441NAC domain
PROSITE profilePS5100557.38810161IPR003441NAC domain
PfamPF023653.0E-2711138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MADFSSSNGV PPGFRFHPTD EELLLYYLKK KIGFEKFDLE VIREVDLNKI EPWDLQERCR  60
IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR  120
GRAPHGQKSD WIMHEYRLEE IDEAQGGTSE DGWVVCRVFK KKCFFKISGG GGGGGEGSTS  180
QSAEAGGGHQ LAVTSPLAMA SHYMHGMHHP QYHQQQHASS FYYSQMQPPE AAYSHHVQVQ  240
DLLTNHRPAA ADAGYGFSGL PPAAVEGLDV GSSDGADGLV AEGRDDHATN GHAADEQQQQ  300
QWQASMDGFS NGAQQMSALN SSGQRGGEMD LWGYGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-551016217166NAC domain-containing protein 19
4dul_A6e-551016217166NAC domain-containing protein 19
1ut7_B6e-551016217166NO APICAL MERISTEM PROTEIN
1ut7_A6e-551016217166NO APICAL MERISTEM PROTEIN
1ut4_B6e-551016217166NO APICAL MERISTEM PROTEIN
1ut4_A6e-551016217166NO APICAL MERISTEM PROTEIN
3swp_D9e-551016220169NAC domain-containing protein 19
3swp_C9e-551016220169NAC domain-containing protein 19
3swp_B9e-551016220169NAC domain-containing protein 19
3swp_A9e-551016220169NAC domain-containing protein 19
3swm_D9e-551016220169NAC domain-containing protein 19
3swm_C9e-551016220169NAC domain-containing protein 19
3swm_B9e-551016220169NAC domain-containing protein 19
3swm_A9e-551016220169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715420.0EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579837.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9SV871e-108BRN2_ARATH; Protein BEARSKIN2
TrEMBLI1IY550.0I1IY55_BRADI; Uncharacterized protein
STRINGBRADI5G11247.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.17e-89NAC domain containing protein 70